PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0036700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 225aa    MW: 25262.2 Da    PI: 8.9141
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0036700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-1661106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l ++v+++G+++Wk+Ia++++  R++k+c++rw++ 
   Spipo2G0036700  61 RGHWKPAEDTKLRELVALYGPHNWKLIAEKLQ-SRSGKSCRLRWFNQ 106
                      899*****************************.***********996 PP

2Myb_DNA-binding53.55.4e-17114156246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++ +eE+e+l  a++++G++ W+ Ia+ ++ gRt++ +k++w+ 
   Spipo2G0036700 114 RAFNEEEEERLMAAHRMYGNR-WAMIAKLFP-GRTDNAVKNHWHV 156
                      5799*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.5856107IPR017930Myb domain
SMARTSM007172.2E-1460109IPR001005SANT/Myb domain
SuperFamilySSF466893.48E-2861154IPR009057Homeodomain-like
PfamPF002491.6E-1661106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2562114IPR009057Homeodomain-like
CDDcd001673.58E-1364105No hitNo description
PROSITE profilePS5129426.061108162IPR017930Myb domain
SMARTSM007173.7E-14112160IPR001005SANT/Myb domain
PfamPF002494.9E-14114155IPR001005SANT/Myb domain
CDDcd001672.59E-11115155No hitNo description
Gene3DG3DSA:1.10.10.602.0E-20115160IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEDHHPDGRN VDVASDSGSD VFGRSNGNDR EDESLSGEDT RDGVQCGKEA DDNGPAKVCS  60
RGHWKPAEDT KLRELVALYG PHNWKLIAEK LQSRSGKSCR LRWFNQLDPR INKRAFNEEE  120
EERLMAAHRM YGNRWAMIAK LFPGRTDNAV KNHWHVIMAR RRRERNSSIV YGGRKLSQAV  180
PLGSAMKISV ALDRASNRGG GGGFSYSEFC PNPIYAIEFS RDIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32611617107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781016.15e-76PREDICTED: myb-like protein AA
TrEMBLW9S0B17e-74W9S0B1_9R
STRINGVIT_01s0026g02600.t017e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-67myb domain protein 105